Pfam domain
Pfam family: GST_N (PF02798.22)
Uniprot AC: P0ACA3
RecName: Stringent starvation protein A
Begin-End: 9-81
Organism: Escherichia coli
Interaction Mode:   

Sequence:
SVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELT
LWESRIIMEYLDE
Structures of the domain P0ACA3 9-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7c97 X-ray 3.68 I 9-81 None
7c97 X-ray 3.68 J 10-81 None


© NPIDB team 2003 - 2021

text