Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: P0ACF0
RecName: DNA-binding protein HU-alpha
Begin-End: 1-90
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTG
RNPQTGKEIKIAAANVPAFVSGKALKDAVK
Structures of the domain P0ACF0 1-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oaj X-ray 4.09 D 1-76  H-Bb L-Bb 
6oaj X-ray 4.09 C 1-78  S-Bb L-Bb L-Mj 
6oaj X-ray 4.09 B 1-90  H-Bb 
6oaj X-ray 4.09 A 1-76 None
4yey X-ray 3.35 C 1-75  H-Bb 
4yey X-ray 3.35 A 1-75 None
6o8q X-ray 3.22 J 1-90 None
6o8q X-ray 3.22 I 1-77  H-Bb L-Bb 
6o8q X-ray 3.22 H 1-90  H-Bb H-Mj 
6o8q X-ray 3.22 G 1-90  H-Bb L-Bb 
6o8q X-ray 3.22 E 1-75  L-Bb 
6o8q X-ray 3.22 F 1-90  L-Bb 
6o8q X-ray 3.22 D 1-76 None
6o8q X-ray 3.22 C 1-90  S-Bb L-Bb 
6o8q X-ray 3.22 A 1-76  L-Bb 
6o8q X-ray 3.22 B 1-90  H-Bb H-Mj L-Bb 
4yex X-ray 3.2 C 1-76  H-Bb 
4yex X-ray 3.2 A 1-75 None
4yf0 X-ray 2.79 B 1-90 None
4yf0 X-ray 2.79 A 1-78 None
4yew X-ray 2.68 C 1-76 None
4yft X-ray 2.91 C 1-76 None
6o6k X-ray 3.6 B 1-77  L-Bb 
6o6k X-ray 3.6 A 1-78  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text