Pfam domain
Pfam family: HTH_18 (PF12833.9)
Uniprot AC: P0ACH5
RecName: Multiple antibiotic resistance protein MarA
Begin-End: 31-110
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
VSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQ
TLTRTFKNYFDVPPHKYRMT
Structures of the domain P0ACH5 31-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1xs9 NMR A 33-112  H-Bb H-Mj L-Bb 
1bl0 X-ray 2.3 A 33-112  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text