Pfam domain
Pfam family: HTH_Crp_2 (PF13545.8)
Uniprot AC: P0ACJ8
RecName: cAMP-activated global transcriptional regulator CRP
Begin-End: 142-206
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
GRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHG
KTIVV
Structures of the domain P0ACJ8 142-206
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1run X-ray 2.7 B 141-205 None
1run X-ray 2.7 A 141-206 None
1zrd X-ray 2.8 B 141-206 None
1zrd X-ray 2.8 A 141-206 None
1o3s X-ray 3 A 141-206 None
1ruo X-ray 2.7 A 141-206 None
1ruo X-ray 2.7 B 141-206 None
3iyd X-ray 19.8 H 141-206 None
3iyd X-ray 19.8 G 141-206  H-Bb L-Bb 
1o3t X-ray 2.8 B 141-205 None
1o3t X-ray 2.8 A 141-206 None
1o3q X-ray 3 A 141-206 None
1lb2 X-ray 3.1 A 141-206 None
2cgp X-ray 2.2 A 141-206  H-Bb H-Mj L-Bb L-Mj 
1zre X-ray 2.8 B 141-206 None
1zre X-ray 2.8 A 141-206 None
1o3r X-ray 3 A 141-206 None
1zrf X-ray 2.1 B 141-206 None
1zrf X-ray 2.1 A 141-206 None
1j59 X-ray 2.5 A 141-206 None
1j59 X-ray 2.5 B 141-205 None
1zrc X-ray 2.8 B 141-206 None
1zrc X-ray 2.8 A 141-206 None
1cgp X-ray 3 B 141-205  H-Bb H-Mj L-Bb L-Mj 
1cgp X-ray 3 A 141-205  H-Bb H-Mj L-Bb 
3n4m X-ray 2.99 A 141-206  H-Bb H-Mj S-Bb L-Bb 
5ciz X-ray 5.01 A 141-206  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text