Pfam domain
Pfam family: HTH_Crp_2 (PF13545.8)
Uniprot AC: P0ACK0
RecName: cAMP-activated global transcriptional regulator CRP
Begin-End: 142-207
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
GRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHG
KTIVVY
Structures of the domain P0ACK0 142-207
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pb5 X-ray 4.52 G 141-205  H-Bb H-Mj 
6pb5 X-ray 4.52 H 141-205  H-Bb H-Mj L-Bb 
6b6h X-ray 3.9 H 141-205  H-Bb H-Mj L-Bb 
6b6h X-ray 3.9 G 141-205  H-Bb H-Mj 
6pb6 X-ray 4.29 G 141-205  H-Bb H-Mj L-Bb 
6pb6 X-ray 4.29 H 141-205  H-Bb H-Mj L-Bb 
6pb4 X-ray 4.35 G 141-205  H-Bb H-Mj L-Bb L-Mj 
6pb4 X-ray 4.35 H 141-205  H-Bb 


© NPIDB team 2003 - 2021

text