Pfam domain
Pfam family: cNMP_binding (PF00027.31)
Uniprot AC: P0ACK0
RecName: cAMP-activated global transcriptional regulator CRP
Begin-End: 21-110
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
IHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEG
QERSAWVRAKTACEVAEISYKKFRQLIQVN
Structures of the domain P0ACK0 21-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pb5 X-ray 4.52 G 22-108 None
6pb5 X-ray 4.52 H 22-108 None
6b6h X-ray 3.9 H 22-108 None
6b6h X-ray 3.9 G 22-108 None
6pb6 X-ray 4.29 G 22-108 None
6pb6 X-ray 4.29 H 22-108 None
6pb4 X-ray 4.35 G 22-108 None
6pb4 X-ray 4.35 H 22-108 None


© NPIDB team 2003 - 2021

text