Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: P0ACT4
RecName: Tetracycline repressor protein class D
Begin-End: 9-55
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDAL
Structures of the domain P0ACT4 9-55
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1qpi X-ray 2.5 A 9-55 None


© NPIDB team 2003 - 2021

text