Pfam domain
Pfam family: Inositol_P (PF00459.27)
Uniprot AC: P0ADG4
RecName: Nus factor SuhB
Begin-End: 1-263
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYP
QHTIITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPM
RNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNECA
DFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTG
NIVAGNPRVVKAMLANMRDELSD
Structures of the domain P0ADG4 1-263
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tqn X-ray 3.8 S 0-263 None
6tqn X-ray 3.8 T 1-262 None
6tqo X-ray 3.8 S 0-263 None
6tqo X-ray 3.8 T 1-262 None


© NPIDB team 2003 - 2021

text