Pfam domain
Pfam family: Resolvase (PF00239.23)
Uniprot AC: P0ADI2
RecName: Transposon Tn3 resolvase
Begin-End: 3-139
Organism: Escherichia coli
Interaction Mode:   

Sequence:
IFGYARVSTSQQSLDIQIRALKDAGVKANRIFTDKASGSSTDREGLDLLRMKVEEGDVIL
VKKLDRLGRDTADMIQLIKEFDAQGVAVRFIDDGISTDGDMGQMVVTILSAVAQAERRRI
LERTNEGRQEAKLKGIK
Structures of the domain P0ADI2 3-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5cy1 X-ray 3.4 B 3-139  H-Bb H-Mj H-Mn 
5cy1 X-ray 3.4 A 3-139  L-Bb 
5cy2 X-ray 4 B 3-139  H-Bb H-Mn 
5cy2 X-ray 4 A 3-143  L-Bb L-Mn 
5cy2 X-ray 4 F 3-139  H-Bb H-Mn 
5cy2 X-ray 4 E 3-144  L-Bb L-Mn 


© NPIDB team 2003 - 2021

text