Pfam domain
Pfam family: Ribosomal_S15 (PF00312.24)
Uniprot AC: P0ADZ4
RecName: 30S ribosomal protein S15
Begin-End: 8-87
Organism: Escherichia coli
Interaction Mode:   

Sequence:
TAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLL
DYLKRKDVARYTQLIERLGL
Structures of the domain P0ADZ4 8-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vaz X-ray 10 F 107-186 None
5no3 X-ray 5.16 O 8-88 None
5no4 X-ray 5.16 O 8-88 None
6w7w X-ray 3.9 N 7-87 None
2ykr X-ray 9.8 O 7-87 None
5no2 X-ray 5.16 O 8-88 None
4a2i X-ray 16.5 O 7-87 None
4adv X-ray 13.5 O 7-87 None
5my1 X-ray 7.6 O 7-87 None
5me0 X-ray 13.5 O 8-88 None
5me1 X-ray 13.5 O 8-88 None
6xe0 X-ray 6.8 O 7-87 None
5uz4 X-ray 5.8 O 7-87 None
6nqb X-ray 3.8 O 7-87 None
6w7m X-ray 3.8 O 8-88 None
6w77 X-ray 3.6 O 8-88 None
6w7n X-ray 3.4 O 7-87 None
6w6k X-ray 3.6 O 7-87 None


© NPIDB team 2003 - 2021

text