Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: P0AES4
RecName: DNA gyrase subunit A
Begin-End: 32-507
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVR
MAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDG
TEKIPDVMPTKIPNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLMEH
IPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARAEVEVDAKTGRETIIVHEIPYQVNKA
RLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQVSFG
INMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANID
PIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLT
EQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELE
Structures of the domain P0AES4 32-507
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rkv X-ray 4.6 C 32-507  H-Bb S-Bb S-Mj S-Mn L-Bb 
6rkv X-ray 4.6 A 32-507  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
6rku X-ray 4 C 32-507  H-Bb S-Bb S-Mn L-Bb 
6rku X-ray 4 A 32-507  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
6rkw X-ray 6.6 A 32-507  H-Bb S-Bb S-Mj S-Mn L-Bb 
6rkw X-ray 6.6 C 32-507  H-Bb S-Bb S-Mj S-Mn L-Bb 
6rks X-ray 4 C 32-507  H-Bb H-Mj S-Mn L-Bb 
6rks X-ray 4 A 32-507  H-Bb H-Mj S-Bb S-Mn L-Bb 


© NPIDB team 2003 - 2021

text