Pfam domain
Pfam family: DNA_gyraseB (PF00204.27)
Uniprot AC: P0AES6
RecName: DNA gyrase subunit B
Begin-End: 221-391
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGT
HLAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
VSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAARRAREM
Structures of the domain P0AES6 221-391
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rkw X-ray 6.6 D 221-390 None
6rkw X-ray 6.6 B 221-390 None


© NPIDB team 2003 - 2021

text