Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: P0AES6
RecName: DNA gyrase subunit B
Begin-End: 419-532
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGI
GRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIVERGHVYIAQP
Structures of the domain P0AES6 419-532
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rkv X-ray 4.6 D 419-532  L-Bb L-Mn 
6rkv X-ray 4.6 B 419-532  L-Bb 
6rku X-ray 4 B 419-532  S-Bb L-Bb 
6rku X-ray 4 D 419-532  L-Bb 
6rkw X-ray 6.6 D 419-532  L-Bb L-Mn 
6rkw X-ray 6.6 B 419-532  L-Bb 
6rks X-ray 4 B 419-532  L-Bb 
6rks X-ray 4 D 419-532  L-Bb L-Mn 


© NPIDB team 2003 - 2021

text