Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P0AES6
RecName: DNA gyrase subunit B
Begin-End: 731-790
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRA
Structures of the domain P0AES6 731-790
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rkv X-ray 4.6 D 731-790 None
6rkv X-ray 4.6 B 731-790  H-Bb 
6rku X-ray 4 B 731-790 None
6rku X-ray 4 D 731-790 None
6rkw X-ray 6.6 D 731-790 None
6rkw X-ray 6.6 B 731-790 None


© NPIDB team 2003 - 2021

text