Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P0AES6
RecName: DNA gyrase subunit B
Begin-End: 737-790
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRA
Structures of the domain P0AES6 737-790
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rks X-ray 4 B 550-790 None
6rks X-ray 4 D 550-790  L-Bb 


© NPIDB team 2003 - 2021

text