Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: P0AFF6
RecName: Transcription termination/antitermination protein NusA
Begin-End: 131-197
Organism: Escherichia coli
Interaction Mode:   

Sequence:
REHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEA
RGAQLFV
Structures of the domain P0AFF6 131-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ms0 X-ray 9.8 M 131-197 None
6tqn X-ray 3.8 A 131-197 None
6flq X-ray 4.1 F 131-197 None
6tqo X-ray 3.8 A 131-197 None
6xas X-ray 3.8 G 131-197 None


© NPIDB team 2003 - 2021

text