Pfam domain
Pfam family: KH_5 (PF13184.8)
Uniprot AC: P0AFF6
RecName: Transcription termination/antitermination protein NusA
Begin-End: 230-298
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMA
PADVASIVV
Structures of the domain P0AFF6 230-298
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ms0 X-ray 9.8 M 230-298 None
6tqn X-ray 3.8 A 230-298 None
6flq X-ray 4.1 F 230-298 None
6tqo X-ray 3.8 A 230-298 None


© NPIDB team 2003 - 2021

text