Pfam domain
Pfam family: NusA_N (PF08529.13)
Uniprot AC: P0AFF6
RecName: Transcription termination/antitermination protein NusA
Begin-End: 25-124
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPTKEITLEAARYED
ESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERA
Structures of the domain P0AFF6 25-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xav X-ray 7.7 G 25-124 None


© NPIDB team 2003 - 2021

text