Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: P0AFF8
RecName: Transcription termination/antitermination protein NusA
Begin-End: 131-197
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
REHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEA
RGAQLFV
Structures of the domain P0AFF8 131-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lm7 X-ray 3.35 A 131-197 None
5lm7 X-ray 3.35 C 131-197 None
6gov X-ray 3.7 A 131-197 None


© NPIDB team 2003 - 2021

text