Pfam domain
Pfam family: KH_5 (PF13184.8)
Uniprot AC: P0AFF8
RecName: Transcription termination/antitermination protein NusA
Begin-End: 230-298
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
PGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMA
PADVASIVV
Structures of the domain P0AFF8 230-298
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lm7 X-ray 3.35 A 230-298 None
5lm7 X-ray 3.35 C 230-298 None
6gov X-ray 3.7 A 230-298 None


© NPIDB team 2003 - 2021

text