Pfam domain
Pfam family: NusA_N (PF08529.13)
Uniprot AC: P0AFF8
RecName: Transcription termination/antitermination protein NusA
Begin-End: 4-124
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
EILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWL
VVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAER
A
Structures of the domain P0AFF8 4-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lm7 X-ray 3.35 A 4-124 None
5lm7 X-ray 3.35 C 4-124 None
6gov X-ray 3.7 A 4-124 None


© NPIDB team 2003 - 2021

text