Pfam domain
Pfam family: KOW (PF00467.31)
Uniprot AC: P0AFG0
RecName: Transcription termination/antitermination protein NusG
Begin-End: 130-165
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIF
Structures of the domain P0AFG0 130-165
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ms0 X-ray 9.8 F 130-165 None
6tqn X-ray 3.8 G 130-165 None
6xe0 X-ray 6.8 V 130-165 None
6duq X-ray 3.7 X 133-166 None
6duq X-ray 3.7 Q 133-166 None
6duq X-ray 3.7 R 133-166 None
6duq X-ray 3.7 V 133-166 None
6duq X-ray 3.7 W 133-166 None
6duq X-ray 3.7 P 133-166 None
6duq X-ray 3.7 N 133-166 None
6duq X-ray 3.7 O 133-166 None
6duq X-ray 3.7 T 133-166 None
6duq X-ray 3.7 U 133-166 None
6duq X-ray 3.7 M 133-166 None
6duq X-ray 3.7 S 133-166 None
6tqo X-ray 3.8 G 130-165 None


© NPIDB team 2003 - 2021

text