Pfam domain
Pfam family: NusG (PF02357.21)
Uniprot AC: P0AFG0
RecName: Transcription termination/antitermination protein NusG
Begin-End: 7-112
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFP
GYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIM
Structures of the domain P0AFG0 7-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ms0 X-ray 9.8 F 7-112  L-Bb 
6tqn X-ray 3.8 G 7-112 None
6xav X-ray 7.7 L 7-112 None
6c6u X-ray 3.7 N 7-112  L-Bb 
6tqo X-ray 3.8 G 7-112 None


© NPIDB team 2003 - 2021

text