Pfam domain
Pfam family: KOW (PF00467.31)
Uniprot AC: P0AFG1
RecName: Transcription termination/antitermination protein NusG
Begin-End: 130-165
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
PGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIF
Structures of the domain P0AFG1 130-165
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gov X-ray 3.7 G 130-165 None


© NPIDB team 2003 - 2021

text