Pfam domain
Pfam family: NusG (PF02357.21)
Uniprot AC: P0AFW0
RecName: Transcription antitermination protein RfaH
Begin-End: 2-97
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDP
EVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLS
Structures of the domain P0AFW0 2-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c6s X-ray 3.7 D 2-97  L-Bb L-Mn 
5ond X-ray 2.1 B 2-97 None
5ond X-ray 2.1 A 2-97 None
6c6t X-ray 3.5 D 2-97  L-Bb 


© NPIDB team 2003 - 2021

text