Pfam domain
Pfam family: ATP-synt_ab (PF00006.27)
Uniprot AC: P0AG30
RecName: Transcription termination factor Rho
Begin-End: 158-354
Organism: Escherichia coli
Interaction Mode:   

Sequence:
TARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVT
EMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTV
VPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKG
TGNMELHLSRKIAEKRV
Structures of the domain P0AG30 158-354
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ht1 X-ray 3.51 B 158-354 None
2ht1 X-ray 3.51 A 158-354 None
6xav X-ray 7.7 F 158-353 None
6xas X-ray 3.8 F 158-353 None


© NPIDB team 2003 - 2021

text