Pfam domain
Pfam family: ATP-synt_ab (PF00006.27)
Uniprot AC: P0AG30
RecName: Transcription termination factor Rho
Begin-End: 158-365
Organism: Escherichia coli
Interaction Mode:   

Sequence:
TARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVT
EMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTV
VPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKG
TGNMELHLSRKIAEKRVFPAIDYNRSGT
Structures of the domain P0AG30 158-365
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1xpr X-ray 3.15 F 158-365 None
1xpr X-ray 3.15 E 158-365 None
1xpr X-ray 3.15 D 158-365 None
1xpr X-ray 3.15 C 158-365 None
1xpr X-ray 3.15 B 158-365 None
1xpr X-ray 3.15 A 158-365 None
5jjk X-ray 3.15 B 158-365 None
5jjk X-ray 3.15 E 158-365 None
5jjk X-ray 3.15 F 158-365 None
5jjk X-ray 3.15 C 158-365 None
5jjk X-ray 3.15 A 158-365 None
5jjk X-ray 3.15 D 158-365 None
5jjl X-ray 3.2 C 158-365 None
5jjl X-ray 3.2 D 158-365 None
5jjl X-ray 3.2 E 158-365 None
5jjl X-ray 3.2 F 158-365 None
5jjl X-ray 3.2 A 158-365 None
5jjl X-ray 3.2 B 158-365 None
1xpu X-ray 3.05 F 158-365 None
1xpu X-ray 3.05 E 158-365 None
1xpu X-ray 3.05 D 158-365 None
1xpu X-ray 3.05 C 158-365 None
1xpu X-ray 3.05 B 158-365 None
1xpu X-ray 3.05 A 158-365 None
3ice X-ray 2.8 E 158-365 None
3ice X-ray 2.8 F 158-365 None
3ice X-ray 2.8 D 158-365 None
3ice X-ray 2.8 C 158-365 None
3ice X-ray 2.8 B 158-365 None
3ice X-ray 2.8 A 158-365 None
1pvo X-ray 3 F 158-365 None
1pvo X-ray 3 E 158-365 None
1pvo X-ray 3 D 158-365 None
1pvo X-ray 3 C 158-365 None
1pvo X-ray 3 A 158-365 None
1pvo X-ray 3 B 158-365 None
1xpo X-ray 3.15 F 158-365 None
1xpo X-ray 3.15 E 158-365 None
1xpo X-ray 3.15 D 158-365 None
1xpo X-ray 3.15 C 158-365 None
1xpo X-ray 3.15 B 158-365 None
1xpo X-ray 3.15 A 158-365 None
1pv4 X-ray 3 F 158-365 None
1pv4 X-ray 3 E 158-365 None
1pv4 X-ray 3 D 158-365 None
1pv4 X-ray 3 C 158-365 None
1pv4 X-ray 3 B 158-365 None
1pv4 X-ray 3 A 158-365 None
5jji X-ray 2.6 F 158-365 None
5jji X-ray 2.6 A 158-365 None
5jji X-ray 2.6 E 158-365 None
5jji X-ray 2.6 D 158-365 None
5jji X-ray 2.6 C 158-365 None
5jji X-ray 2.6 B 158-365 None
6xav X-ray 7.7 E 158-365 None
6xav X-ray 7.7 C 158-365 None
6xav X-ray 7.7 D 158-365 None
6xav X-ray 7.7 A 158-365 None
6xav X-ray 7.7 B 158-365 None
6duq X-ray 3.7 J 158-365 None
6duq X-ray 3.7 K 158-365 None
6duq X-ray 3.7 I 158-365 None
6duq X-ray 3.7 H 158-365 None
6duq X-ray 3.7 G 158-365 None
6duq X-ray 3.7 L 158-365 None
6duq X-ray 3.7 F 158-365 None
6duq X-ray 3.7 E 158-365 None
6duq X-ray 3.7 D 158-365 None
6duq X-ray 3.7 C 158-365 None
6duq X-ray 3.7 B 158-365 None
6duq X-ray 3.7 A 158-365 None
6xas X-ray 3.8 C 158-365 None
6xas X-ray 3.8 A 158-365 None
6xas X-ray 3.8 B 158-365 None
6xas X-ray 3.8 D 158-365 None
6xas X-ray 3.8 E 158-365 None


© NPIDB team 2003 - 2021

text