Pfam domain
Pfam family: Ribosomal_S17 (PF00366.22)
Uniprot AC: P0AG63
RecName: 30S ribosomal protein S17
Begin-End: 10-77
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECRPLSK
TKSWTLVR
Structures of the domain P0AG63 10-77
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 Q 10-77 None
5no4 X-ray 5.16 Q 10-77 None
6w7w X-ray 3.9 P 10-77 None
2ykr X-ray 9.8 Q 9-76 None
5no2 X-ray 5.16 Q 10-77 None
4a2i X-ray 16.5 Q 9-76 None
4adv X-ray 13.5 Q 9-76 None
5my1 X-ray 7.6 Q 9-76 None
5me0 X-ray 13.5 Q 10-77 None
5me1 X-ray 13.5 Q 10-77 None
6xe0 X-ray 6.8 Q 9-76 None
6nqb X-ray 3.8 Q 9-76 None
6w7m X-ray 3.8 Q 10-77 None
6w77 X-ray 3.6 Q 10-77 None
6w7n X-ray 3.4 Q 9-76 None
6w6k X-ray 3.6 Q 9-76 None


© NPIDB team 2003 - 2021

text