Pfam domain
Pfam family: Metallophos (PF00149.30)
Uniprot AC: P0AG76
RecName: Nuclease SbcCD subunit D
Begin-End: 1-226
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQTHQVDAIIVAGDVFDTGSPPSYAR
TLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDIMAFLNTTVVASAGHAPQILPRRDG
TPGAVLCPIPFLRPRDIITSQAGLNGIEKQQHLLAAITDYYQQHYADACKLRGDQPLPII
ATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPPADYIALGHIHRA
Structures of the domain P0AG76 1-226
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6s85 X-ray 4.2 A 1-226  S-Bb L-Bb 
6s85 X-ray 4.2 B 1-226 None


© NPIDB team 2003 - 2021

text