Pfam domain
Pfam family: Sigma70_r4_2 (PF08281.14)
Uniprot AC: P0AGB6
RecName: ECF RNA polymerase sigma-E factor
Begin-End: 122-181
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
MLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAI
Structures of the domain P0AGB6 122-181
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2h27 X-ray 2.3 D 128-181  H-Bb H-Mj L-Bb 
2h27 X-ray 2.3 A 128-181  H-Bb H-Mj L-Bb 
6jbq X-ray 4.02 F 122-181  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text