Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: P0AGB6
RecName: ECF RNA polymerase sigma-E factor
Begin-End: 25-92
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKN
YLVAQGRR
Structures of the domain P0AGB6 25-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5or5 NMR A 25-92 None
6jbq X-ray 4.02 F 25-92  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text