Pfam domain
Pfam family: SRP_SPB (PF02978.21)
Uniprot AC: P0AGD7
RecName: Signal recognition particle protein
Begin-End: 329-427
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKER
AKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMM
Structures of the domain P0AGD7 329-427
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pxp X-ray 2.5 A 1-81 None
2pxv X-ray 2 A 1-81 None
1hq1 X-ray 1.52 A 12-79 None
2pxe X-ray 2 A 1-81 None
2pxf X-ray 2 A 1-81 None
5aka X-ray 5.7 5 328-427 None
2pxk X-ray 2.5 A 1-81 None
2pxt X-ray 2.5 A 1-81 None
5gaf X-ray 4.3 i 290-427 None
2xxa X-ray 3.94 C 328-427 None
2xxa X-ray 3.94 A 328-427 None
2pxl X-ray 2.5 A 1-81 None
1dul X-ray 1.8 A 1-81 None
2pxq X-ray 2.5 A 1-81 None
2pxd X-ray 2 A 1-81 None
3lqx X-ray 1.93 A 1-81 None
2pxb X-ray 2.5 A 1-81 None
2pxu X-ray 2.5 A 1-81 None
5gag X-ray 3.8 i 2-101 None
2j28 X-ray 8 9 328-427 None
5gah X-ray 3.8 i 328-427 None
5gad X-ray 3.7 i 328-427 None


© NPIDB team 2003 - 2021

text