Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P0C0S8
RecName: Histone H2A type 1
Begin-End: 10-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGN
AARDNKKTRIIPRHLQLAIRND
Structures of the domain P0C0S8 10-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7joa X-ray 3.3 G 10-90 None
7joa X-ray 3.3 C 10-90 None
7jo9 X-ray 3.3 C 10-90 None
7jo9 X-ray 3.3 G 10-90 None
6xjd X-ray 6.8 C 10-90  H-Bb S-Bb S-Mn L-Bb L-Mn 
6xjd X-ray 6.8 G 10-90  H-Bb S-Bb S-Mn L-Bb L-Mn 
6rny X-ray 3.9 G 9-90 None
6rny X-ray 3.9 C 9-90 None
6fml X-ray 4.34 S 12-90 None
5kgf X-ray 4.54 G 9-90 None
5kgf X-ray 4.54 C 9-90 None
6x59 X-ray 2.98 G 10-90  H-Bb S-Bb L-Bb 
6x59 X-ray 2.98 C 10-90  H-Bb S-Bb L-Bb L-Mn 
6x5a X-ray 4.36 G 10-90  H-Bb S-Bb L-Bb 
6x5a X-ray 4.36 C 10-90  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text