Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P0C0S8
RecName: Histone H2A type 1
Begin-End: 17-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKK
TRIIPRHLQLAIRND
Structures of the domain P0C0S8 17-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fml X-ray 4.34 O 16-90 None
6r0c X-ray 4.2 G 14-90 None
6r0c X-ray 4.2 C 16-90 None


© NPIDB team 2003 - 2021

text