Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: P0C0W1
RecName: 40S ribosomal protein S22-A
Begin-End: 5-130
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQ
LNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKHVSGK
ILGFVY
Structures of the domain P0C0W1 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 W 5-130 None
6zce X-ray 5.3 X 5-130 None
6zvi X-ray 3 E 4-130 None
5ll6 X-ray 3.9 b 5-130 None
6rbe X-ray 3.8 W 5-130 None
6rbd X-ray 3.47 W 5-130 None
5tzs X-ray 5.1 E 5-130 None
6y7c X-ray 3.8 W 5-130 None
5jpq X-ray 7.3 z 5-130 None
6eml X-ray 3.6 b 5-130 None
7a1g X-ray 3 b 23-148 None
6zu9 X-ray 6.2 b 7-132 None
6wdr X-ray 3.7 W 5-130 None


© NPIDB team 2003 - 2021

text