Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.21)
Uniprot AC: P0CL77
RecName: DNA polymerase 1
Begin-End: 127-278
Organism: Pyrococcus abyssi
Interaction Mode:  H-Bb L-Bb 

Sequence:
TPMEGNEELTFLAVDIETLYHEGEEFGKGPIIMISYADEEGAKVITWKSIDLPYVEVVSS
EREMIKRLVKVIREKDPDVIITYNGDNFDFPYLLKRAEKLGIKLPLGRDNSEPKMQRMGD
SLAVEIKGRIHFDLFPVIRRTINLPTYTLEAV
Structures of the domain P0CL77 127-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4flw X-ray 2.15 A 127-278  H-Bb 
4fly X-ray 2.3 A 127-278  H-Bb L-Bb 
4flt X-ray 2.9 A 127-278  H-Bb 
4flz X-ray 3.2 A 127-278  H-Bb 
4fm2 X-ray 2.9 A 127-278  H-Bb 
4fm1 X-ray 3 A 127-278  H-Bb 
4flx X-ray 2.9 A 127-278  H-Bb 
4fm0 X-ray 3.12 A 127-278  H-Bb 
4flv X-ray 2.7 A 127-278  H-Bb 


© NPIDB team 2003 - 2021

text