Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P0CX29
RecName: 40S ribosomal protein S23-A
Begin-End: 31-144
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPND
GCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPR
Structures of the domain P0CX29 31-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 X 31-144 None
6zce X-ray 5.3 Y 31-144 None
6zvi X-ray 3 H 31-144 None
5ll6 X-ray 3.9 c 31-144 None
6rbe X-ray 3.8 X 31-144 None
6rbd X-ray 3.47 X 31-144 None
6y7c X-ray 3.8 X 31-144 None
6eml X-ray 3.6 c 31-144 None
7a1g X-ray 3 c 31-144 None
6zu9 X-ray 6.2 c 49-162 None
6wdr X-ray 3.7 X 31-144 None


© NPIDB team 2003 - 2021

text