Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P0CX29
RecName: 40S ribosomal protein S23-A
Begin-End: 43-143
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKP
Structures of the domain P0CX29 43-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tzs X-ray 5.1 r 3-87 None


© NPIDB team 2003 - 2021

text