Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P0CX35
RecName: 40S ribosomal protein S4-A
Begin-End: 42-90
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LPLIVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVI
Structures of the domain P0CX35 42-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 E 42-90 None
6zce X-ray 5.3 F 49-90 None
6zvi X-ray 3 m 42-90 None
5ll6 X-ray 3.9 S 42-90 None
6rbe X-ray 3.8 E 42-90 None
6rbd X-ray 3.47 E 42-90 None
5tzs X-ray 5.1 5 42-90 None
6y7c X-ray 3.8 E 42-90 None
6eml X-ray 3.6 S 42-90 None
7a1g X-ray 3 S 42-90 None
6zu9 X-ray 6.2 S 42-90 None
6wdr X-ray 3.7 E 42-90 None


© NPIDB team 2003 - 2021

text