Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: P0CX51
RecName: 40S ribosomal protein S16-A
Begin-End: 11-143
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRVT
GGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFG
GKGARSRFQKSYR
Structures of the domain P0CX51 11-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zce X-ray 5.3 R 11-143 None
6zvi X-ray 3 y 11-143 None
6rbe X-ray 3.8 Q 11-143 None
5jpq X-ray 7.3 x 11-143 None
6eml X-ray 3.6 F 10-143 None
7a1g X-ray 3 F 10-143 None
6zu9 X-ray 6.2 H 11-143 None


© NPIDB team 2003 - 2021

text