Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P0DMI1
RecName: ATP-dependent DNA helicase Hel308
Begin-End: 25-186
Organism: Archaeoglobus fulgidus
Interaction Mode:   

Sequence:
ELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEK
YESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVV
DEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVT
Structures of the domain P0DMI1 25-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2p6r X-ray 3 A 27-188 None


© NPIDB team 2003 - 2021

text