Pfam domain
Pfam family: HIN (PF02760.17)
Uniprot AC: P0DOV2
RecName: Interferon-activable protein 204
Begin-End: 225-393
Organism: Mus musculus
Interaction Mode:   

Sequence:
HSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFII
ISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVF
TLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHL
Structures of the domain P0DOV2 225-393
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5z7d X-ray 4.5 C 225-393 None
5z7d X-ray 4.5 B 225-393  H-Bb L-Bb 
5z7d X-ray 4.5 A 225-393  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text