Pfam domain
Pfam family: HIN (PF02760.17)
Uniprot AC: P0DOV2
RecName: Interferon-activable protein 204
Begin-End: 429-595
Organism: Mus musculus
Interaction Mode:   

Sequence:
HHGPKQVMVLKVTEPFTYDLKEDKRMFHATVATETEFFRVKVFDTALKSKFIPRNIIAIS
DYFGCNGFLEIYRASCVSDVNVNPTMVISNTLRQRANATPKISYLFSQARGTFVSGEYLV
NKKTERNKFIYYGIGDDTGKMEVVVYGRLTNVRCEPGSKLRLVCFEL
Structures of the domain P0DOV2 429-595
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5z7d X-ray 4.5 B 429-595  H-Bb 
5z7d X-ray 4.5 C 429-595 None
5z7d X-ray 4.5 A 429-595 None


© NPIDB team 2003 - 2021

text