Pfam domain
Pfam family: Pou (PF00157.19)
Uniprot AC: P10037
RecName: Pituitary-specific positive transcription factor 1
Begin-End: 128-197
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
EIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLK
AILSKWLEEA
Structures of the domain P10037 128-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1au7 X-ray 2.3 B 6-103  H-Bb H-Mj L-Bb L-Mj 
1au7 X-ray 2.3 A 6-75  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text