Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: P10037
RecName: Pituitary-specific positive transcription factor 1
Begin-End: 216-271
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
KRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKR
Structures of the domain P10037 216-271
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1au7 X-ray 2.3 B 74-158  H-Bb H-Mj L-Bb L-Mn 
1au7 X-ray 2.3 A 76-158  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text