Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P10085
RecName: Myoblast determination protein 1
Begin-End: 110-161
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQ
Structures of the domain P10085 110-161
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mdy X-ray 2.8 C 110-161  H-Bb H-Mj 
1mdy X-ray 2.8 D 110-161  H-Bb H-Mj 
1mdy X-ray 2.8 B 110-161  H-Bb H-Mj L-Bb 
1mdy X-ray 2.8 A 110-161  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text