Pfam domain
Pfam family: Linker_histone (PF00538.21)
Uniprot AC: P10412
RecName: Histone H1.4
Begin-End: 37-108
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQT
KGTGASGSFKLN
Structures of the domain P10412 37-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7k5y X-ray 2.76 U 36-107  H-Bb S-Bb 


© NPIDB team 2003 - 2021

text