Pfam domain
Pfam family: HHH_6 (PF14579.8)
Uniprot AC: P10443
RecName: DNA polymerase III subunit alpha
Begin-End: 808-898
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GLKILPPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCA
RTDTKKLNRRVLEKLIMSGAFDRLGPHRAAL
Structures of the domain P10443 808-898
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fkw X-ray 7.3 A 808-897  L-Bb 
5m1s X-ray 6.7 A 808-897  H-Bb 
5fkv X-ray 8 A 808-897  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text