Pfam domain
Pfam family: Methylase_S (PF01420.21)
Uniprot AC: P10485
RecName: Type-1 restriction enzyme EcoR124II specificity protein
Begin-End: 13-182
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GVEVEWLPLGEITKYEQPTKYLVKAKDYHDTYTIPVLTAGKTFILGYTNETHGIYQASKA
PVIIFDDFTTANKWVDFDFKAKSSAMKMVTSCDDNKTLLKYVYYWLNTLPSEFAEGDHKR
QWISNYSQKKIPIPCPDNPEKSLAIQSEIVRILDKFTALTAELTAELNMR
Structures of the domain P10485 13-182
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7btq X-ray 4.54 E 13-182  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text