Pfam domain
Pfam family: Methylase_S (PF01420.21)
Uniprot AC: P10485
RecName: Type-1 restriction enzyme EcoR124II specificity protein
Begin-End: 198-381
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EGEVEWKTLGEIGKWYGGGTPSKNKIEFWENGSIPWISPKDMGRTLVDSSEDYITEEAVL
HSSTKLIPANSIAIVVRSSILDKVLPSALIKVPATLNQDMKAVIPHENILVKYIYHMIGS
RGSDILRAAKKTGGSVASIDSKKLFSFKIPVPNINEQQRIVEILDKFDTLTNSITEGLPR
EIEL
Structures of the domain P10485 198-381
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7btq X-ray 4.54 E 198-381  H-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text